DPCfam | MC315509
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Residues in low-complexity regions (%) | 6.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.61 |
| Average transmembrane regions | 1.19 |
| Dominant Pfam architecture(s) | PF06713 |
| Sequences matching dominant architecture (%) | 95.94 |
| Average overlap percent | 62.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A34FB9E | 32-140 | 109 | AKGTLEQYPVHAAVYVLTAALVWWPIFSTRYKIDADTLLVQSMLFKWRIPLQQIQKVAATDHSIASPALSLDRLKIEYEQNGQAK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37523-F1 | 21-139 | 87.07 | 81.55 | View in AlphaFoldDB ↗ |