DPCfam | MC315491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 163 ± 11 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00780 |
| Sequences matching dominant architecture (%) | 98.81 |
| Average overlap percent | 56.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M8A7L6 | 1022-1180 | 159 | TFTLDTLDTMDPVGSLRRGRRIASHTSFFKAGICMGRTLVCVVKSGSLSSTIKTLEPIEYNPRGKKQQTLRRFRPGGQETLRVFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Y7U6-F1 | 1071-1223 | 97.52 | 81.66 | View in AlphaFoldDB ↗ |