DPCfam | MC315443
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 461 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Residues in low-complexity regions (%) | 0.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.71 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01793 |
| Sequences matching dominant architecture (%) | 99.56 |
| Average overlap percent | 31.57 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150XR21 | 228-302 | 75 | YDNWGYFNNFFISKLSFWKSEPVQHFLHHFDQMGASHIYRWNDLVMQSAAVQIFMEKERVHKFEDWTYEHATIRK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P46592-F1 | 336-419 | 98.82 | 98.32 | View in AlphaFoldDB ↗ |