DPCfam | MC315212
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 260 ± 38 aa |
| Residues in low-complexity regions (%) | 6.94 |
| Residues in coiled-coil regions (%) | 16.29 |
| Predicted disordered residues (%) | 14.4 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF14938 |
| Sequences matching dominant architecture (%) | 21.43 |
| Average overlap percent | 61.45 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085NT76 | 448-723 | 276 | WQTFRAIHARLKKRSFRKPNLGEAAREYVALAKRLEQEECSSYEALALVYAARCESQLKNTEQEAANFKKAARLFIHHEKSKCSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A2BIC9-F1 | 6-285 | 99.64 | 83.67 | View in AlphaFoldDB ↗ |