DPCfam | MC315123
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02753 |
| Sequences matching dominant architecture (%) | 15.0 |
| Average overlap percent | 76.47 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1Y470 | 161-236 | 76 | LTITNDSAYVVRMDQGIKLLPGDVELALPKSYLLPGSKTVVDLPGQGKDGKALKPDFKQIQITPFTAYGYAAAPYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZJV4-F1 | 163-233 | 96.00 | 93.48 | View in AlphaFoldDB ↗ |