DPCfam | MC315083
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 1.02 |
| Predicted disordered residues (%) | 1.51 |
| Average transmembrane regions | 2.81 |
| Dominant Pfam architecture(s) | PF01490 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2LGS1 | 187-293 | 107 | MYMETDSSKYPVVCYADLGERIFGRVTRHIFNVVQSLQLVFNVALLIIGNGQTLVTMIEWKFCYLALNIFFMLIGMIAGQVRSLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q0C4-F1 | 197-309 | 99.12 | 87.51 | View in AlphaFoldDB ↗ |