DPCfam | MC315008
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Residues in low-complexity regions (%) | 13.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.53 |
| Average transmembrane regions | 1.94 |
| Dominant Pfam architecture(s) | PF11694 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 97.63 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D0DM54 | 1-142 | 142 | MDFYSLDYIQNQESFNSSLIMGSIIISVILLIWAVIFYFRHNYDIKYRDIALIFGLFISIQVFRQVENYNQSKQQGNKTSQMAPF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CYC7-F1 | 2-79 | 54.93 | 87.94 | View in AlphaFoldDB ↗ |