DPCfam | MC31499
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 29.24 |
| Predicted disordered residues (%) | 24.19 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13304 |
| Sequences matching dominant architecture (%) | 0.8 |
| Average overlap percent | 38.95 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4YSY8 | 1027-1127 | 101 | WTRKHNALAAQQASKMGEMKSKDDQLMQLLADWNTDYKDAAQKYKEAHIKVETTKAAVEDLGRYGSALDKAIMKYHSLKMEEINR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MYA5-F1 | 1084-1182 | 97.06 | 88.51 | View in AlphaFoldDB ↗ |