DPCfam | MC31430
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Residues in low-complexity regions (%) | 6.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.88 |
| Average transmembrane regions | 0.99 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A139IB92 | 536-614 | 79 | YQTRWAYAAGAIASTLFCIICILPVFWGYWQLGRKVTLGPFEIAHAFRSPMTAQASTGDIEEVIQEVGKHKVQYGRIVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2HDC7-F1 | 564-670 | 91.11 | 70.24 | View in AlphaFoldDB ↗ |