DPCfam | MC31410
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 29.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00015 |
| Sequences matching dominant architecture (%) | 0.33 |
| Average overlap percent | 3.43 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P9SBZ6 | 4-143 | 140 | RVSLDDLFDRNYKPVPNTSPTRFTTRFDRYTDQVLPALQEPLLSRHEGLVFAIACTQQGYVPTHNNAFSQPLTGDATVDNARNRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HWB0-F1 | 361-514 | 98.72 | 92.59 | View in AlphaFoldDB ↗ |