DPCfam | MC31407
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Residues in low-complexity regions (%) | 3.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16841 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 71.88 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S3WUR6 | 91-216 | 126 | LSVTAKATLSDGAGPDVQVRVNGVDQGRFTVNSTDYTVYKIPLTADLKSTDSVDLFFGNDAMNQTGDRNLWVRSISGGNGVDLSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59674-F1 | 256-360 | 95.83 | 88.35 | View in AlphaFoldDB ↗ |