DPCfam | MC313820
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 414 ± 64 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05970 |
| Sequences matching dominant architecture (%) | 73.26 |
| Average overlap percent | 16.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146GZW6 | 1151-1536 | 386 | RVVRAPNQEVNLHFIGRWFLRNEDGTREYYCAQMLLLFTPWRELSELPRSHSTFESAFNTFLRGASAEQKRIIQNIHYFYECSDH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UUA2-F1 | 229-381 | 40.00 | 56.15 | View in AlphaFoldDB ↗ |