DPCfam | MC313620
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 228 ± 42 aa |
| Residues in low-complexity regions (%) | 5.35 |
| Residues in coiled-coil regions (%) | 0.39 |
| Predicted disordered residues (%) | 39.71 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04870 |
| Sequences matching dominant architecture (%) | 78.95 |
| Average overlap percent | 17.65 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158R690 | 15-238 | 224 | VIWLYQCYGEVKITRENMPGAQYYDGKKLNIPISTEAGKEIYERWAFQSMSGLISSIANKRAEQMNEYYKNRLFKCSKSSETVFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FZ80-F1 | 5-213 | 94.76 | 67.87 | View in AlphaFoldDB ↗ |