DPCfam | MC313514
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 183 ± 19 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.75 |
| Average transmembrane regions | 0.45 |
| Dominant Pfam architecture(s) | PF11444 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 96.16 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1VA52 | 11-207 | 197 | RDAHITTLRGIILLLAVGCVFLWKGWKDAPEELTVYYPPDLRGGTSQSAWEIPPNNAYQFGWYVWQRLNRWPTNGEADYKRNIHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GXM0-F1 | 14-203 | 100.00 | 92.32 | View in AlphaFoldDB ↗ |