DPCfam | MC31348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 261 ± 51 aa |
| Residues in low-complexity regions (%) | 17.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.83 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF03544 |
| Sequences matching dominant architecture (%) | 20.0 |
| Average overlap percent | 24.86 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R8B3Y3 | 44-317 | 274 | PWLPLPEIEREEKERIPPALAKVLVEQRKVAPPPPPPEPVKEEVSEQPKPKKETAPKPAPRKEVQAARKKVSTMGVAAFSDELSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1DB00-F1 | 471-641 | 56.95 | 60.42 | View in AlphaFoldDB ↗ |