DPCfam | MC31333
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 279 ± 63 aa |
| Residues in low-complexity regions (%) | 4.54 |
| Residues in coiled-coil regions (%) | 1.87 |
| Predicted disordered residues (%) | 36.98 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10513 |
| Sequences matching dominant architecture (%) | 77.44 |
| Average overlap percent | 42.72 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4F9W3 | 166-352 | 187 | GRGIHVFYDMTVADMEWLKQYNSGAAPEDQLKEDDFAWMMHSLEWEHQYNPTQPPESLSNEWGVSQLTQLNRSRDQARHLKPHVC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6CEV5-F1 | 25-340 | 99.63 | 82.41 | View in AlphaFoldDB ↗ |