DPCfam | MC313285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Residues in low-complexity regions (%) | 5.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08167 |
| Sequences matching dominant architecture (%) | 88.89 |
| Average overlap percent | 82.98 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0G6Y3 | 39-170 | 132 | NIENVVSLVNSLLNVSADYEKGVLILKVLLPQCKSDLVERNLLQWLQQCLKGLQSHSYLVTPYALLRELLIYSKDYPDIRKQTAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1W1Y5-F1 | 82-217 | 98.56 | 89.27 | View in AlphaFoldDB ↗ |