DPCfam | MC31328
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 419 ± 70 aa |
| Residues in low-complexity regions (%) | 6.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.91 |
| Average transmembrane regions | 0.89 |
| Dominant Pfam architecture(s) | PF00801 |
| Sequences matching dominant architecture (%) | 12.73 |
| Average overlap percent | 11.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A3AA40 | 22-401 | 380 | YELVLSNDGPITTGAHGTVEARLVPKPGSRQEQLEPQPYTFHWNVESPLAIVRSSEQELTSSITVHSLAPKLYALRAWVTRSGCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VDK9-F1 | 24-526 | 99.26 | 77.61 | View in AlphaFoldDB ↗ |