DPCfam | MC313016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06312 |
| Sequences matching dominant architecture (%) | 90.34 |
| Average overlap percent | 80.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C0HAW7 | 77-266 | 190 | LQWSLPPAFLFSTDEATNPTKCSFSVVNPNSNHTVGGFIDVILIARDTKNRIKTYGGDFFQAKLFNSELKASTYGAVTDHFNGTY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q52KP5-F1 | 94-267 | 99.43 | 96.33 | View in AlphaFoldDB ↗ |