DPCfam | MC312865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.41 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05947 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A068DJH5 | 176-281 | 106 | TTNGIPFKNLALRALTLYLAGPGGIGATVAEQLMGDASAIVARPASLPPPWQEKIPLGQLRQCCLEPDSALLPEVPRSFDGYRLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I744-F1 | 178-278 | 94.44 | 92.84 | View in AlphaFoldDB ↗ |