DPCfam | MC312642
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 143 ± 16 aa |
| Residues in low-complexity regions (%) | 5.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00627 |
| Sequences matching dominant architecture (%) | 23.21 |
| Average overlap percent | 23.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4C3W6 | 1-149 | 148 | MNSLPQQALQAKQSSSCTKIDVHSSNSDVQHLMSIGFDKNDCFYALQYCHGNVDEAAMWLTKHAKIISKKEKNSDFALTGVEIKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7F3W3-F1 | 418-470 | 36.05 | 87.65 | View in AlphaFoldDB ↗ |