DPCfam | MC312627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 186 ± 20 aa |
| Residues in low-complexity regions (%) | 2.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.28 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01172- PF09377 |
| Sequences matching dominant architecture (%) | 85.5 |
| Average overlap percent | 86.38 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003330264 | 6-190 | 185 | PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGXXXXXEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQVIKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8W5Q9-F1 | 10-198 | 98.94 | 80.77 | View in AlphaFoldDB ↗ |