DPCfam | MC312339
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1501 |
|---|---|
| Mean domain length (aa) | 322 ± 58 aa |
| Residues in low-complexity regions (%) | 3.9 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 12.39 |
| Average transmembrane regions | 0.48 |
| Dominant Pfam architecture(s) | PF03456- PF02141 |
| Sequences matching dominant architecture (%) | 47.98 |
| Average overlap percent | 81.06 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947CF50 | 45-394 | 350 | VLKMMPKFCFPLDIGSTTPVSGQHFTFVLTDIDSKQRFGFCRHSPGTRSCLCILSYLPWFEIYYKLLNTLGELLLRKQRSDDVAY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3U1T9-F1 | 41-366 | 99.35 | 93.96 | View in AlphaFoldDB ↗ |