DPCfam | MC312303
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 251 ± 42 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07719 |
| Sequences matching dominant architecture (%) | 24.24 |
| Average overlap percent | 12.8 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6T0R6 | 59-319 | 261 | NDSGNGRLILVNYESDTVAHELNSFAHPMGAAVSDTGTYILVDAGCGSELEGSLVAIDSEGNELYRKCYHANIFNIGISDCGRYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DHE6-F1 | 350-400 | 20.29 | 98.13 | View in AlphaFoldDB ↗ |