DPCfam | MC312061
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Residues in low-complexity regions (%) | 0.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.59 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14704 |
| Sequences matching dominant architecture (%) | 86.42 |
| Average overlap percent | 88.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7TQE4 | 45-223 | 179 | FNFQCPHGEVLVAIRSYFMEAEGSDRLWTFECQPTPPSLGEPTECWWDDINRAGMEWCYNGSEIFHLRRLLSALTNGAAFPARDP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RHW2-F1 | 30-146 | 89.47 | 97.63 | View in AlphaFoldDB ↗ |