DPCfam | MC312
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Residues in low-complexity regions (%) | 5.34 |
| Residues in coiled-coil regions (%) | 0.67 |
| Predicted disordered residues (%) | 27.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13569 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082ADB7D | 850-925 | 76 | RKSLPKPGAKDDPEAAEAAYQRFAQMKKDVRAVASGEVHRLERAMVTGRRWTAEEFRTHVVEHPLIRHLARRLVWQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32EJ2-F1 | 174-255 | 94.25 | 94.66 | View in AlphaFoldDB ↗ |