DPCfam | MC311749
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Residues in low-complexity regions (%) | 4.2 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 22.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12145 |
| Sequences matching dominant architecture (%) | 1.19 |
| Average overlap percent | 6.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5T087 | 136-329 | 194 | SAAKQFVEEDTNTAGNSDIGSTAIQLLELICRQEWTKRKFLHSTDLFDPKRLLNPLVNQTQAQRLLRMITRSDSEILLKKFDSCT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86YW9-F1 | 1236-1434 | 99.44 | 70.69 | View in AlphaFoldDB ↗ |