DPCfam | MC311615
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 172 ± 21 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9VGN8 | 1346-1529 | 184 | DIAPKGIIGNKAFADLLLDLVTLNLGTNNFPSSWMNLTQPELQELASLLVTNSESVDWRKFLLVVALPWPIPLEEELLETLQRFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9C093-F1 | 1483-1657 | 99.42 | 83.54 | View in AlphaFoldDB ↗ |