DPCfam | MC3116
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 54 ± 5 aa |
| Residues in low-complexity regions (%) | 0.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00106 |
| Sequences matching dominant architecture (%) | 86.36 |
| Average overlap percent | 4.84 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K2YMT6 | 165-228 | 64 | VLGAHLAYTDTPMTANLDVPKSDPAVIVGRILDALEAGEDEAIADETTAGFRSVLGQATTGRIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O53324-F1 | 172-224 | 96.36 | 95.61 | View in AlphaFoldDB ↗ |