DPCfam | MC31153
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 12.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.58 |
| Average transmembrane regions | 1.1 |
| Dominant Pfam architecture(s) | PF02096 |
| Sequences matching dominant architecture (%) | 95.16 |
| Average overlap percent | 13.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174QVS5 | 6-92 | 87 | SLLLFLVLTIGLLSGCSISTEPITAAIATGLWDKLFVLPLANFITFLYNILNNNLGLSIILATAIVRLVLIPLYLKSNQSTMVMQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q926Q5-F1 | 10-97 | 97.75 | 85.23 | View in AlphaFoldDB ↗ |