DPCfam | MC311498
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 275 ± 38 aa |
| Residues in low-complexity regions (%) | 17.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.93 |
| Average transmembrane regions | 5.65 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7QFD4 | 95-435 | 341 | RQRQRWYRWPRKIGPVEITLLVLLGPVVGKLSGAGWGAVVADFLANILVLALVYLLTAYAILPVLKWAVRHSIDELGNLGNLASK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O33248-F1 | 99-379 | 98.62 | 82.47 | View in AlphaFoldDB ↗ |