DPCfam | MC311012
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 157 ± 30 aa |
| Residues in low-complexity regions (%) | 5.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5E4X4 | 265-428 | 163 | CQPRHQSLTPSKPNIHYDAAKIFLIESLTGLVKDATSFATELNGLSYCELPYPDNENEVIQIPTNSDHGEKTAIIRMFRTKLRNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q12507-F1 | 201-345 | 97.53 | 70.78 | View in AlphaFoldDB ↗ |