DPCfam | MC310995
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 260 ± 38 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 24.29 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14214 |
| Sequences matching dominant architecture (%) | 74.5 |
| Average overlap percent | 7.9 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7ZG94 | 722-1014 | 293 | DLRGRTDQESVFGQISHYYATVETNDRGSLHLHGLLLLEDNMQLPSLVDNMAKPEEEGYRAQVVRYLDSVFHECLDEEAGKAVRK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QM52-F1 | 957-1240 | 98.39 | 75.13 | View in AlphaFoldDB ↗ |