DPCfam | MC310762
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1821 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Residues in low-complexity regions (%) | 2.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04314 |
| Sequences matching dominant architecture (%) | 90.32 |
| Average overlap percent | 87.64 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8DUR4 | 14-134 | 121 | AGAELLVHEPWVREAPPTAKMLAGYMSLHNNGDRPIDVVAVDSPAFGAVEMHRSELHEGVARMVQQDKLSVAPGGSLELAPGGYH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HXL0-F1 | 23-143 | 95.80 | 96.76 | View in AlphaFoldDB ↗ |