DPCfam | MC310713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Residues in low-complexity regions (%) | 4.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.59 |
| Average transmembrane regions | 2.63 |
| Dominant Pfam architecture(s) | PF07690 |
| Sequences matching dominant architecture (%) | 67.5 |
| Average overlap percent | 27.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000457526D | 219-331 | 113 | TGRSKYSTEVILLFICYILYDFSVTGGANVVSLFVLKPPLSWDSVWVGYGKAASYVLFLTSFLGVLIFSRWMSDTSLVLMGIISN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7EYZ9-F1 | 264-365 | 99.03 | 91.25 | View in AlphaFoldDB ↗ |