DPCfam | MC309471
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.84 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00172 |
| Sequences matching dominant architecture (%) | 0.32 |
| Average overlap percent | 25.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094J4S6 | 478-572 | 95 | SLSSFGPTIPVRLGDIVLARSGDKGSNLNCGLFVKDSKLWEWFRAFLSRAQFKELLDGDWADEYWLERVEFPGIHAVHFVIYGIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2F0N9-F1 | 511-613 | 98.04 | 96.84 | View in AlphaFoldDB ↗ |