DPCfam | MC309444
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 198 ± 30 aa |
| Residues in low-complexity regions (%) | 3.18 |
| Residues in coiled-coil regions (%) | 0.29 |
| Predicted disordered residues (%) | 8.59 |
| Average transmembrane regions | 1.03 |
| Dominant Pfam architecture(s) | PF08613 |
| Sequences matching dominant architecture (%) | 63.16 |
| Average overlap percent | 44.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9WV85 | 34-256 | 223 | RIRRRLYYGWDWEADCSLEELSSPVADIAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9BV87-F1 | 34-253 | 99.54 | 90.62 | View in AlphaFoldDB ↗ |