DPCfam | MC309275
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 157 ± 26 aa |
| Residues in low-complexity regions (%) | 2.69 |
| Residues in coiled-coil regions (%) | 0.49 |
| Predicted disordered residues (%) | 18.45 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04499 |
| Sequences matching dominant architecture (%) | 66.97 |
| Average overlap percent | 46.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2AN34 | 622-771 | 150 | GDLLKIALKDSGIVNVIVDMFFKFEWNNFLHNVVFDIIQQIFNGPLKQGFNKFLISDLLVNCKLTHKIIQGDKKCLDDEKKTGIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O75170-F1 | 349-539 | 98.69 | 79.64 | View in AlphaFoldDB ↗ |