DPCfam | MC308590
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1411 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 4.07 |
| Residues in coiled-coil regions (%) | 1.22 |
| Predicted disordered residues (%) | 26.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02601 |
| Sequences matching dominant architecture (%) | 79.84 |
| Average overlap percent | 28.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W7YL12 | 301-383 | 83 | RRGDLDHIPAQLNSRINHFFQTKKSQLNLHEKTNNLLNPDNILKKGYSITYHNGKVLKDAKDLKSGDEISTRFDQGTVESIVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6EGZ4-F1 | 364-442 | 97.53 | 84.37 | View in AlphaFoldDB ↗ |