DPCfam | MC308320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 473 ± 61 aa |
| Residues in low-complexity regions (%) | 7.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.65 |
| Average transmembrane regions | 0.98 |
| Dominant Pfam architecture(s) | PF15037- PF08357 |
| Sequences matching dominant architecture (%) | 75.0 |
| Average overlap percent | 85.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087Y9C5 | 238-619 | 382 | IPSYLIAPCLCFLAWFDSKDMKGKYCPFTNKTDALRRMQNNVSVAMVESPLSSGGTGLSWNVTSPCKVQTEVQLCKKDMAGGQCE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BH06-F1 | 130-586 | 98.77 | 82.39 | View in AlphaFoldDB ↗ |