DPCfam | MC308228
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Residues in low-complexity regions (%) | 1.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.72 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016TIX8 | 34-149 | 116 | ALLLLAIVSCALACDIIVHVKSDTDKKFGAQVTASNGKKSEKWTYAKKLQKNTFQQKADECGLKDWEIATFDESGKPAHTVKVTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q23642-F1 | 5-119 | 99.17 | 90.38 | View in AlphaFoldDB ↗ |