DPCfam | MC308196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.68 |
| Average transmembrane regions | 1.01 |
| Dominant Pfam architecture(s) | PF14296 |
| Sequences matching dominant architecture (%) | 23.96 |
| Average overlap percent | 26.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00040B5A37 | 293-392 | 100 | FAAGDFDGYQSMMHGVYWAQEFGLYLGSGLVNSALSVIPRQVWPDKPVHSGQIVSEWLGSANTNLSMPLFGEAYLNFHLFGALLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A235-F1 | 250-337 | 86.14 | 90.84 | View in AlphaFoldDB ↗ |