DPCfam | MC307787
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 173 ± 13 aa |
| Residues in low-complexity regions (%) | 6.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01471 |
| Sequences matching dominant architecture (%) | 3.12 |
| Average overlap percent | 0.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D9MLZ5 | 186-367 | 182 | LPALVEIDSAVTVGSQLNGGEQTLYSFSDQPTLSLSTLPAQEKILTEAKELKVNVDNQQVPVVISDKKSTEDGASTVFTFTAANG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I3R2-F1 | 87-139 | 31.95 | 97.85 | View in AlphaFoldDB ↗ |