DPCfam | MC307692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 325 ± 44 aa |
| Residues in low-complexity regions (%) | 4.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02119 |
| Sequences matching dominant architecture (%) | 92.62 |
| Average overlap percent | 95.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q52082 | 12-359 | 348 | LLLSCAFAAQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFTLQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVHAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q748F5-F1 | 19-365 | 98.53 | 82.43 | View in AlphaFoldDB ↗ |