DPCfam | MC307647
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.03 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF10783 |
| Sequences matching dominant architecture (%) | 96.95 |
| Average overlap percent | 91.94 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3EMX8 | 374-486 | 113 | PTPVAPAPSYIASADWIKRYDPGTRKDEWTLSVVPTATGRALPNKQAGALYDQLFTLKGADSNWRDNEHSAGSMRQQLSCVLANY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2J0-F1 | 297-406 | 98.02 | 95.05 | View in AlphaFoldDB ↗ |