DPCfam | MC307228
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 180 ± 32 aa |
| Residues in low-complexity regions (%) | 8.93 |
| Residues in coiled-coil regions (%) | 7.3 |
| Predicted disordered residues (%) | 43.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08641 |
| Sequences matching dominant architecture (%) | 90.45 |
| Average overlap percent | 57.5 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I1S1Z8 | 11-197 | 187 | QRKIELQAPEDLSYLIANVRRAAAERLNEAFPPVEGADGEDELRNQIEKLVNDYIDKTFSLASPNLSINGLPVVANTFLSETPAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W1I0-F1 | 6-245 | 100.00 | 73.93 | View in AlphaFoldDB ↗ |