DPCfam | MC306715
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 269 ± 26 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10633 |
| Sequences matching dominant architecture (%) | 13.12 |
| Average overlap percent | 10.77 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5S551 | 574-840 | 267 | KVYNKNLDQHINAAIELTVNNNKHLYTHYLREIKYDHIPDIHYLYKDNILVLNDEIKTVGKKIGYIVGAGDKVPEALEQLGYDVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P33747-F1 | 272-345 | 27.24 | 90.40 | View in AlphaFoldDB ↗ |