DPCfam | MC3066
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 186 ± 12 aa |
| Residues in low-complexity regions (%) | 2.57 |
| Residues in coiled-coil regions (%) | 1.05 |
| Predicted disordered residues (%) | 14.7 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U2PNI5 | 26-204 | 179 | WKKMINALNDVDYNRYYDIIDSFSCKMTFSAFDRENMRLSGFIAQNRKDDVENQIKMMMNMRIKPKQKVALGTRGFYYYLEQGKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LT27-F1 | 330-449 | 65.96 | 94.52 | View in AlphaFoldDB ↗ |