DPCfam | MC306403
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 222 ± 36 aa |
| Residues in low-complexity regions (%) | 3.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13391 |
| Sequences matching dominant architecture (%) | 7.84 |
| Average overlap percent | 22.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L9REN8 | 2-202 | 201 | CWACDAPSLEVAHVVARQDTAINELTARGLIDFDLKSKQNTVGLCPNCHGWFDNAMDPGFCFLPADLDFFIRFELKDRAKRRAAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NTK6-F1 | 81-325 | 98.68 | 87.32 | View in AlphaFoldDB ↗ |