DPCfam | MC306303
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 244 ± 43 aa |
| Residues in low-complexity regions (%) | 4.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.08 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF15865 |
| Sequences matching dominant architecture (%) | 81.82 |
| Average overlap percent | 42.57 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3AVM6 | 349-598 | 250 | VQQVLETHEVNWQHVLSCVSTLLVCQPQAQQLLKDLLTRLLNNAFEIYDLETLIIAFLLARQAALEGPAVFIPYSEWFKISFGNS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O15360-F1 | 353-625 | 99.64 | 82.05 | View in AlphaFoldDB ↗ |